SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008926 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008926
Domain Number 1 Region: 38-177
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.85e-22
Family DEP domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008926   Gene: ENSOGAG00000009992   Transcript: ENSOGAT00000009996
Sequence length 509
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:59885631:59911023:1 gene:ENSOGAG00000009992 transcript:ENSOGAT00000009996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVREKAAALNHLPLHGPAHKPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHHLK
RHDDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEPVPTKVFGKDK
KPTFEDSSYSFYRFTTMPNQNSQLGEENRLCSPSRYADALSMSPDIKSASLEDLWENLSL
KPANSPHDTSATLSPQVINEVWQEETIGRLLQLIDLPLLDSLLKQQEAVPKAKRQSDVVN
NSNYLDREILKAYGDSQEDEWLSAAIDCLEYLPDQMVVDISRNFPEQPDRTDLVKELLFD
AIGRYYSSREPLLNHLSDVHNGIAELLAKVNGKTEIALEATQLVLKLLDSQNREEFRRLL
HFMAVAAHPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKI
PGTLHKIVSIKLMAIQKGRDPNRDAGYIYCKRIDESDYSSSTQKKTKDELLNLLKTINED
SKLSAKEKKKLLDHFYKSHPNIFIEYFEG
Download sequence
Identical sequences H0X1P4
ENSOGAP00000008926 ENSOGAP00000008926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]