SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008982 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008982
Domain Number 1 Region: 5-326,439-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.99e-49
Family FAD-linked reductases, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.06e-22
Family L-aminoacid/polyamine oxidase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008982   Gene: ENSOGAG00000010055   Transcript: ENSOGAT00000010057
Sequence length 477
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:30000772:30004729:-1 gene:ENSOGAG00000010055 transcript:ENSOGAT00000010057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTVVVLGGGISGLAASYHLSRASHPPKVILVEGSERLGGWIRSVRGSDGAIFELGPRG
IRPAGALGARTLLMVSELGLDSQVLRVRGDHPAAQNRFLYVGGALHALPTDLRGLLRPSP
PFSKPLFWAGLRDLTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAERTHRSILLGLLLGAGQSSQLDSALIRQARTERWSQWSFRGGLEMLPQAL
ESHLTSRGVRVLRGQPVSGLSLHAEGRWKVSLGDSSLEADHIISAVPASVLSKLLPAKAA
PLACALSTITAVSVAVVNLQYQGACLPVQGFGHLVPSSEDPGILGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTMEANGCVLSQELLQQKAQEAVATQLGLKEPPSYCLVHLHKNCIP
QYTLGHWQKLESAKQFLAAQRLPLTLAGASYEGVAVNDCIESGRQAAFSVLGTEPHS
Download sequence
Identical sequences H0X1U6
ENSOGAP00000008982 XP_012658108.1.62490 ENSOGAP00000008982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]