SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008992 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008992
Domain Number 1 Region: 44-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008992   Gene: ENSOGAG00000010066   Transcript: ENSOGAT00000010068
Sequence length 258
Comment pep:known_by_projection scaffold:OtoGar3:GL873556.1:12005915:12018607:1 gene:ENSOGAG00000010066 transcript:ENSOGAT00000010068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGSILDVYTGEQGISPVKMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIER
RRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKL
EQANRRLLLRIQELEIQARAHGLPPLASLGTIDLGADVTKQQSHREQNSVDYCQLLTLPQ
GPSLELCDQAMAFSDPLSHFTDLSFSAALKEEQRLDDMLLDDTISPFGTDPLLSAISPAV
SKESSRRSSFSSDDGDEL
Download sequence
Identical sequences H0X1V5
ENSOGAP00000008992 ENSOGAP00000008992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]