SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009042 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009042
Domain Number 1 Region: 237-304
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009042
Domain Number - Region: 294-383
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0942
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009042   Gene: ENSOGAG00000010116   Transcript: ENSOGAT00000010120
Sequence length 482
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:12284532:12290658:-1 gene:ENSOGAG00000010116 transcript:ENSOGAT00000010120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQLGGLPPRPHPRPLPVTA
TCARGGAEESSPSPPPQVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGS
PKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVIDNIMRLDDVLGYI
NPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESGALAKER
QKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQK
SRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEE
GPGEALMMGAEVPDPEPLPALPPQAPLGPPAQPPSPFHHLDFSHSLSFGGGDDEGPPGYP
GPLGPEHGSPFPNLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGD
VL
Download sequence
Identical sequences H0X1Z8
ENSOGAP00000009042 ENSOGAP00000009042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]