SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009094 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009094
Domain Number 1 Region: 92-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1190-1444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 532-761
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-29
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 870-1025,1065-1141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009094
Domain Number - Region: 1452-1531
Classification Level Classification E-value
Superfamily EF-hand 0.00164
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009094   Gene: ENSOGAG00000010170   Transcript: ENSOGAT00000010175
Sequence length 1976
Comment pep:known_by_projection scaffold:OtoGar3:GL873672.1:2997887:3023473:-1 gene:ENSOGAG00000010170 transcript:ENSOGAT00000010175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEGKKDTTPEPSPANGAGPGPEWGLCPGPPAMEGESNGASGLGTPRRRTQHSKHKTV
AIASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGSGRACTMNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEDLDIEDPT
EDGNLGSMAEEGRAGHRPQLAELTNRKRGRLRWFSHSTRSTHSTSSHASLPASDTGSMAE
TPGDEEEEEGAVASCTRCLNKIMKTRFCRRLRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPVWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSTYVSSFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREKSSEK
DVPQENGVLVPGGEKEEEEGARSEAAVSGMEEEEEEEEEEEEEEGGAGRVELLQEVVPKE
KVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTNLILVFIILSSVSLAAEDPIRAHSFR
NHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSS
AISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQ
LFKGKFYSCTDEAKHTPQECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALF
TVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITF
RAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYHVWATVNSAAFEYLMFLLI
LLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTFDAL
IVVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTF
IKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCP
HRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKR
MKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNEAPSSTSSALQAG
LRSLQDLGPEIRQALTCDTEEEEEEQEGEEEEDEKESERNKAVTDSQTPSRRGSRISISL
PVGDKLPDSVSLGPSDDDGGAPNPRQPSVSQAGSHTHRRGSGALIFTIPEEGSSEPRGTN
GQDKQNEEEEVPDRLSYLDEQAGTLPRPVLLPPHRTQRYTEEHHAPRRRLLPPTPAGRKP
SFAIQCLQRQGSCEDLPIPGTYHRGRNSGPTRAQGSWATPPQRGRLLYAPLLLVEEGAAG
EGYLGKSSGPLRTFTCLHVPGTHSDPSRGKRGSADSLVEAVLISEGLGLFARDPCFVALA
KQEIADACRLTLDEMDSAASDLLAQGTNSLYSDEESILSRFDEEDLGDEMACVHAL
Download sequence
Identical sequences H0X238
ENSOGAP00000009094 ENSOGAP00000009094 XP_012666727.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]