SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009121 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009121
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-20
Family Phosphate binding protein-like 0.00000209
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009121
Domain Number - Region: 124-151
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0119
Family Phosphate binding protein-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009121   Gene: ENSOGAG00000010200   Transcript: ENSOGAT00000010205
Sequence length 240
Comment pep:novel scaffold:OtoGar3:GL873629.1:6521880:6835118:1 gene:ENSOGAG00000010200 transcript:ENSOGAT00000010205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDS
KGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKVSLNVTTT
GTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGG
LGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences B5FW46
ENSOGAP00000009121 ENSOGAP00000009121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]