SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009139 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009139
Domain Number 1 Region: 556-1018
Classification Level Classification E-value
Superfamily RNI-like 3.92e-40
Family 28-residue LRR 0.0072
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily DEATH domain 1.98e-18
Family Caspase recruitment domain, CARD 0.0039
Further Details:      
 
Domain Number 3 Region: 123-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000867
Family Nucleotide and nucleoside kinases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009139   Gene: ENSOGAG00000010216   Transcript: ENSOGAT00000010223
Sequence length 1024
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:22739060:22773310:-1 gene:ENSOGAG00000010216 transcript:ENSOGAT00000010223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNFIKGNSQVLIQRMGMTVTKQITDDLFVWNVLNCEEVNTIYCEKVEQDAARGVIHMILK
KGSEACNLFLKSLEKCNFPLFQDLNGQSLFHQLSEGDLDDFVQELKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHRRVELLTLSGLLQTLQSPCIIEGESGKGKSTLLQ
RIAMLWGSGGCAALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPETIKRQAFMGMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDGAQALIRAVLLQELAEGLLLQIHKSRCLRNLMKTPLFVVITCALQMGESEFHSHTQT
TLFRAFYDLLIQKNKHKHRGLRASDFTQSLDHCGDLALDGVFSCRFDFQLEDVCSVNEDV
LLTTGLLCKYTAQRFKPTYKFFHKSFQEYTAGRRLSSLLMSREPEEVTKGNSYLQKMVSI
SDITSLYSNLLLYTCGSSTEATRAVMKHLAGVCHHGSLLGLSIPRRLLWRQESMQSVKNT
TEQEVLRAINISSFVECGINLFHESISKSTLSQEFEAFFSGKSLYISSENIPDYLFDFFE
YLPNCASALDFIKLDFYGGATASEAKATGDTSRVPTDKSSETYIPSRAVSLFFNWKQEFK
TLVVTLRDFSKLNKQDIKYLGKIFSSATNLSLYIKRCAGVAGSLSLVLSTCKNIYSLLVE
ASPLTIEDEQHITSVTNLKTLSIHNLQTQRLSGGLTDNLGNLKNLTKLILDNIKMNEADA
IKLAEGLTNLKKMCLFRLTHLSDIGEGVDYIVKSLSSEPRDLEEIQLVSCCLSAHAVKTL
AQNLHNLVKLSILDLSENYLGKDGNEALHELIARLNILEQLTALMLPWCSGVQVSLTSLL
EQLEGVPQLIKLGLKHWRLTDAEIRILGAFFGKNLLKNVQQLDLAGNRVSSDGWLAFMGI
LENLKQLVFFDFSTKEFLPDATLVRKLSHVLAKLTFLQEARLVGWQFDDDDLSVIKGAFK
LVTA
Download sequence
Identical sequences H0X274
ENSOGAP00000009139 ENSOGAP00000009139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]