SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009164 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009164
Domain Number 1 Region: 316-495
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.45e-33
Family Phospholipase D 0.05
Further Details:      
 
Domain Number 2 Region: 726-942
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.04e-28
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 78-213
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000196
Family PX domain 0.0081
Further Details:      
 
Domain Number 4 Region: 224-329
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000168
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 5 Region: 668-724
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000628
Family Phospholipase D 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009164   Gene: ENSOGAG00000010239   Transcript: ENSOGAT00000010250
Sequence length 1075
Comment pep:known_by_projection scaffold:OtoGar3:GL873597.1:9276102:9483803:1 gene:ENSOGAG00000010239 transcript:ENSOGAT00000010250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRNKPRVNTSALQRIAADMSDLIGSLDSRELHFEGEEVEYDASSGDPRAQEEYIPFSA
VYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFTWQVKRKF
KHFQEFHRELLKYKAFIRIPLPTRRHTFRRQNVKGEEPREMPSLPRSSENRIREEQFFGR
RKQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLN
CCGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVGKKETETKYGLRI
DNLSRTLILKCNSYRHARWWAGAIEEFIQKHGTNFLKDHRFGSYAAVQENMLAKWYVNAK
GYFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIML
YKEVELALGINSEYSKRTLMSLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGG
IDLAYGRWDDHEHRLTDVGSVKRVTSGAPLGSLPAATSESMESLHPKDKNEPNKSLPILK
SADDIDSRLKGAGKPRKPSRFSLYRQLYQRHLQDTDSVTSMDSASSYFNHCRSHQNLIHG
LKPHFRLFRPCSESEQGLSGPRADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQ
LDKPFADFIDRYSTPRMPWHDIASVVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFL
LPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHTAYVYVIENSKHYIYV
ENQFFISCADDKTVFNKVGDAIAQRILKAHRENKRYRVYVVIPLLPGFEGDISTGGGNAL
QAIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHADLEGNLVTELIYVHSKL
LIADDNTVIIGSANINDRSMLGRRDSEMAIIVQDTETVPSVMDGEEYQAGRFAHGLRLQC
FRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPSDEVHTLIQLREF
RNKPRLSEEDPIRAEEELKKIRGFLVQFPFYFLSEENLLPSVGTKEAIVPVEVWT
Download sequence
Identical sequences H0X295
XP_003794342.1.62490 ENSOGAP00000009164 ENSOGAP00000009164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]