SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009194 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009194
Domain Number 1 Region: 368-482,602-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 13-349
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.24e-38
Family L-arabinose binding protein-like 0.013
Further Details:      
 
Domain Number 3 Region: 498-601
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000366
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009194   Gene: ENSOGAG00000010277   Transcript: ENSOGAT00000010282
Sequence length 867
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:22512979:22677019:-1 gene:ENSOGAG00000010277 transcript:ENSOGAT00000010282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYPISQVRYSPPHPLPQVIISYTVDSMEMFTQLICSQFSKGVYAIFGFYERRTVNMLTSF
CGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRDLSLQNE
MELWKEKQAQLDFIAVHILWVESEIRILVSQDISSKRDKFLVDSLISEYPTGLRRKIIKL
EKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHT
RVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQR
ALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGG
DNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIV
SDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIK
KPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTS
DQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLT
VERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRT
TEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNP
VNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGL
AMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGGSGENGRVV
SHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences H0X2C0
ENSOGAP00000009194 ENSOGAP00000009194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]