SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009304 from Otolemur garnettii 76_3

(show help)
Strong hits

Sequence:	ENSOGAP00000009304
Domain Number 1	Region: 84-147
Classification Level	Classification	E-value
Superfamily	BPTI-like	2.41e-17
Family	Small Kunitz-type inhibitors & BPTI-like toxins	0.0057
Further Details:

Domain Number 2	Region: 41-91
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.000000000523
Family	Elafin-like	0.0028
Further Details:

Domain Number 3	Region: 150-193
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.000000017
Family	Elafin-like	0.0017
Further Details:

Domain Number 4	Region: 195-243
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.000000366
Family	Elafin-like	0.0013
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSOGAP00000009304 Gene: ENSOGAG00000010398 Transcript: ENSOGAT00000010401
Sequence length	245
Comment	pep:known_by_projection scaffold:OtoGar3:GL873542.1:7713160:7725012:-1 gene:ENSOGAG00000010398 transcript:ENSOGAT00000010401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	KYSTMAEYGAHLPLHISALSWRNVAFLVLLSLSLDQTSATLTNKIQQKPGTCIPERVNCF LKQVNFCQADFECEESLKCCTFGCRRRCMDPYQEPCTLPLSEGTCRLKIQRWYFDTNENL CKPFAYKSCEGNANNFVRRIDCEKACLLVVKKGQCPLFPFDDRMECPASCKSDIDCPKTD KCCDSTCGFVCAKVWKAHKVKPGFCPPKPLKCEKIHKPSCLKDAECPLIEKCCTDCGLKC MEPES
Download sequence
Identical sequences	H0X2L3 ENSOGAP00000009304 ENSOGAP00000009304

SEARCH