SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009376 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009376
Domain Number 1 Region: 522-554,657-732
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000361
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009376   Gene: ENSOGAG00000010476   Transcript: ENSOGAT00000010480
Sequence length 790
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:3277258:3295589:1 gene:ENSOGAG00000010476 transcript:ENSOGAT00000010480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKTVVCGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNKSYVDTAAMEAERLHVSATLACLT
AIIQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFT
FIDICKNLPHTNIASLIFALISGIFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
CKMPKKYHMQIVGEIQHGFPTPVSPVVSQWKDMVGTAFSLAIVGYVINLAVGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSILVVVFQTQFRNGYALAQVIDTDIYVNPKTYNRVQEIQGIKIVTYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQKRRTMPTQQRKSLFMKTKTVSLQELQQD
FENSSPTDPNNNQTPNNGASVSYITLSPDTSSAGQCEPPASAETPGEPTDMLASVPPFVT
FHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSL
EYSHVFPSIHDAVLFAQANAREGAPGRNFQEAQRDSELSLYDSREDSPSYWDLEQAMFGS
MFHAETLTAL
Download sequence
Identical sequences H0X2S4
XP_012662087.1.62490 ENSOGAP00000009376 ENSOGAP00000009376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]