SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009421 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009421
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000013
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 771-829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000433
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009421   Gene: ENSOGAG00000010521   Transcript: ENSOGAT00000010528
Sequence length 923
Comment pep:known_by_projection scaffold:OtoGar3:GL873615.1:6898183:6919500:1 gene:ENSOGAG00000010521 transcript:ENSOGAT00000010528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPRAQHRPPPQLLFLILLSCPWIQGLPLKEEETLPEPGSETPTIASEALAELIHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAAPSLPWATEPGTGPLTTAVTPKEVRGAGPTAP
ELLTPPPGTTAPPPPGPASPGPSLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLGSTTSRTMGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGTPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGRGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLVCLNGTRPAWSGETPTCLASCGGIIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEERRILLQVEILNVREGDTLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRK
LEVTQTTDPSRQLEGGNLALAILLPLGLVIILGSGVYIYYTKLQGKSLFGFSGSHSYSPI
TVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences H0X2W4
ENSOGAP00000009421 ENSOGAP00000009421 XP_003795842.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]