SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009425 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009425
Domain Number 1 Region: 20-395
Classification Level Classification E-value
Superfamily RNI-like 5.76e-56
Family Cyclin A/CDK2-associated p19, Skp2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009425   Gene: ENSOGAG00000010527   Transcript: ENSOGAT00000010532
Sequence length 423
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:24627242:24703107:1 gene:ENSOGAG00000010527 transcript:ENSOGAT00000010532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF
QRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDA
TCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVKG
CGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDDGLITICRGCHKLQSLC
ASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQIT
DSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLE
HLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCC
IIL
Download sequence
Identical sequences H0X2W7
ENSOGAP00000009425 ENSOGAP00000009425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]