SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009436 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009436
Domain Number 1 Region: 353-541
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.85e-65
Family Regulator of G-protein signaling, RGS 0.00000805
Further Details:      
 
Domain Number 2 Region: 750-979
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-64
Family DBL homology domain (DH-domain) 0.000000000816
Further Details:      
 
Domain Number 3 Region: 983-1113
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-39
Family Pleckstrin-homology domain (PH domain) 0.0000012
Further Details:      
 
Domain Number 4 Region: 52-132
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009436   Gene: ENSOGAG00000010533   Transcript: ENSOGAT00000010543
Sequence length 1526
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:4237009:4389611:-1 gene:ENSOGAG00000010533 transcript:ENSOGAT00000010543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRHGSILNRESPTDKKQKVERIVSHDFDPADSSSKKTKSSSEESRSEIYGLVQRCVIIQK
DDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSG
SYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEE
NNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKAT
GSAQDGAVVIPSRPVGDTLTVSEAEADTGDGLSRTDSSSGDASRPGSDNADSPKSGLKEK
IYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIEL
LKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRIFLEFHQFFLDRSAHLK
VSVPEEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESE
LIKLDAERDKDRVALEKERACAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGV
KVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSILGPPRRPSRQDNSAIGR
AMELQKARHPKHLPTPSSVSPEPQDSAKLRQSGSANEGADTGYLPPNSMSSVASGATLSQ
EGSKENDTGSKQVGETPASGDSLDGTPRTPNTVFEFPPPSLDQVQEEEYEVERVTEHGTP
KPFRKFDPVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPSEIKRQEVINELFY
TERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNE
TSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFHTFVQDAES
NPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPMEREKVKKAADHCRQILNYVNQA
VKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTID
LYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATDNKAL
FVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPLPQSPPGEADNDEE
EPSKLKVEHHGISVPGLQSPDRDLGLESHLISKPPSHSLNTSGKSEVGDLFVAERQFAKE
QHADGTLKEVGINYQIAIPDPHLSVSEERWALDALRNLGLLKQLLIQQLGLTEKSTQEDW
QHFPSYRTASQGVQADSGLQTSENAKVYHPGEEQMPFRTGTGDIATCDSPRTSTESSAPR
DSVVLASQDSQASNILVMDHMIMTPEMPTTEPEGGLDESGEHFFDAREAHSDDNPSEGDG
GVKKEEKDVNLRISGNYLILDGYDTVQESSTDEEVASSLTLQPMTGLSSTDSIHQQPHSP
PNAHSDGAVSPFTPEFLVQQRWGAMEDSCFEIQSPSSCVDSQSQIMEYIHKIEADLEHLK
KVEESYTILCQRLAGSALTDKHSVKN
Download sequence
Identical sequences H0X2X7
ENSOGAP00000009436 ENSOGAP00000009436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]