SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009641 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009641
Domain Number 1 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.01e-38
Family Regulator of chromosome condensation RCC1 0.0047
Further Details:      
 
Domain Number 2 Region: 1378-1424,1500-1649
Classification Level Classification E-value
Superfamily VPS9 domain 7.32e-32
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 3 Region: 517-685
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.7e-27
Family beta-lactamase inhibitor protein-II, BLIP-II 0.059
Further Details:      
 
Domain Number 4 Region: 1119-1249
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.85e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.017
Further Details:      
 
Domain Number 5 Region: 1045-1136
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 5.49e-20
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 6 Region: 925-1011
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000113
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 690-889
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000157
Family DBL homology domain (DH-domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009641   Gene: ENSOGAG00000010767   Transcript: ENSOGAT00000010776
Sequence length 1651
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:29257720:29327049:1 gene:ENSOGAG00000010767 transcript:ENSOGAT00000010776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVHVWQAGSFPITPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLSWRSEPAEICPSSPVLENALVGQYVVTVATGSFHNGAVTESGVVYMWGENSA
GQCAVANQQYVPEPSPVSISDSETSPLLSVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTTFPVTKPQKIEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAESHASAAISPSPETLGSQGVENAPAAKDAPVT
TELNGESVQTTSGDAISSQQNIMGTTEISSARNIPSYPDTQAVNEHLQKLSDHSIKEDSE
NSEKPAAPQPLVEEAIPHLHSPSTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKKVM
NFYSTPPCETGAQAGSSAIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSRRL
SLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHG
DVLPRLQPLCVKCLDGKEVIHLEAGSYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTVPR
LAKISSENGVWSIAAGQDYSLFLVDTEDFQPGLYYSGRQEPTEGDNLQENHSGTKTPVLL
SCSKLGYISRVTAGKDSYLTLVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPLLS
LENLGTATTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGIKESRSLVILKHASLFLDSY
TEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLPIR
RLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYESLALHLGRKRKEAEYTLGFWKTFPGK
MTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAE
PLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGTSDLPPYGSGSS
VQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGLED
GYGEYRIPNKAMNKEDHYVGLWKEGKMCGQGVYSHSYASGEVFEGCFQDNMRHGHGLLRS
GKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGLWQDDACQGNGVVVTQFGLYYEG
NFHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKIT
GTYFKPSLYESDKDRPKLFRKLGNLAVPADEKWKAVFDECWRQLGCESPGQGEVWKAWDN
IAVALTTNRRQHKDSPEILSRSQTQTLESLEFIPQHVGTFSVEKYDDIKKYLIKVNYVGL
IRLGVVAQYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAP
LPTERKSFCTGKSDSRSESPEPGYFLGLRAIFLVILSDKVDPPLNNYIIYAIKQKKKNSK
FFSVEQFNTKITIIICGFHCRKFWPVTLSILGDNKKVLPTTKDACFASAVECLQQISTTF
TPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIED
LMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences H0X3E6
ENSOGAP00000009641 ENSOGAP00000009641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]