SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009669 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009669
Domain Number 1 Region: 424-645
Classification Level Classification E-value
Superfamily TPR-like 9.48e-32
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 661-801
Classification Level Classification E-value
Superfamily TPR-like 1.66e-22
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009669
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0156
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009669   Gene: ENSOGAG00000010801   Transcript: ENSOGAT00000010805
Sequence length 915
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:31101487:31143007:-1 gene:ENSOGAG00000010801 transcript:ENSOGAT00000010805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADINLKEVTLIVGVITACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLKNRSS
MIASLLFAVHPVHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTAAGQFLRGKGSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCFLGALGVFSLRYPGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWVCLSVVILTHALK
TLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARRRLLSY
VNEEPQDANGYFNLGMLAMDDSKDTEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLKYYPDHIKGLILKGDILMNQKKDIHGAKKCFEKILELDPTNVQGKHNLCVV
YFEEKDLLKAERCLVETLALAPHEEYIQRHLSIVRDKISSSSFAEQSIFPADKTSVVEEG
DRIPTESVNGILSESRPTQIIKTGDNKSQSKSKQLGKNTDKEMPHKTTKDIKEIEKKRVA
ALKRLEEIERILNGE
Download sequence
Identical sequences H0X3G9
ENSOGAP00000009669 XP_003783419.1.62490 ENSOGAP00000009669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]