SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009720 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009720
Domain Number 1 Region: 946-1076
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-45
Family Regulator of G-protein signaling, RGS 0.00000609
Further Details:      
 
Domain Number 2 Region: 23-149
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.48e-20
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Domain Number 3 Region: 183-263
Classification Level Classification E-value
Superfamily PDZ domain-like 2.93e-17
Family PDZ domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 441-544
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000562
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009720   Gene: ENSOGAG00000010855   Transcript: ENSOGAT00000010863
Sequence length 1082
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:16829472:16938528:1 gene:ENSOGAG00000010855 transcript:ENSOGAT00000010863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMTEFCCSTVSMAVCGLNKSVNIGGYVYVYVYIYIPICPCFLLVIEGKGLMSKEPGVCD
SYVKMSLIPEDNRIHRQKTQTIPGCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASESRQ
GGLIGCMSFGVKSLLTPNKEISGWYYLLREDLGRTKHLKVARRRLRPLRDPLLRMPGGGD
TENGEKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEH
WKCVELAHEIRSCPGEIILLVWRMVPQIKPGPDGGVLRRASCKSTHDLQSPPNKREKNCT
HGVQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGSQHTLPALSRATAPTDPNYIIL
APLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVM
RPHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAQVTLFA
YSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQ
EQKKRVCWCLSENIAKQQQLAASPLESKMFETEADEKRVMPLEEEKGPGAEDPPPSKDSS
PGKELPPGLPPSKDSSSGQELAPGQQSLSSKDGPTSKELPPGQDALPSQDAPPCQEPPAA
QDLPPHQDLPASKEPPPHQEPPLSKDLSAAQEPSAQDPPPCQDLLPSQDALPAKGLTEKT
VGSGDPPATTGDPPEASRPTFVIPEVRLDSAYSQDAGAEGGSSGDEEDAEDAEEGEEGEE
YEDEDTSDDNYGEHSEAKRSSMIETGQGAEGGLSLRMQNSLRRRTHSEGSLLQETRGPCF
TSDTTLHCSDGEGTASSWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDD
ETSRKRKSKNLAKDMKNKLGIFRRRNESPGAPPVGKADKMMKSFKPTSEEALKWSESLEK
LLLHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEYIAIQACK
EVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSP
PL
Download sequence
Identical sequences H0X3K9
ENSOGAP00000009720 ENSOGAP00000009720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]