SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009779 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009779
Domain Number 1 Region: 379-460
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.02e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009779   Gene: ENSOGAG00000010927   Transcript: ENSOGAT00000010929
Sequence length 465
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:7849978:7853637:1 gene:ENSOGAG00000010927 transcript:ENSOGAT00000010929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCSTSIMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSHGYPEFYAHSQSYWATEVVLSENDLWGIPAEEDTFGLGGLGSLTPNPVILQDCMWS
GFSAREKLERAVSEKLQHGRGPPAASSATPAPGTGAASPGGHGHGGAAGASRAGAALPSE
LAHPAAECVDPAVVFPFPVNKREPAPVPASPAAALAAGAAVSSGASAAAPAASPVAVPPR
AGGRPASGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNSKAITTFT
ITMRPKNALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEVSPRPL
KSVMPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELMKNEKAAK
VVILKKATEYVHSLQAEEQQLLQEKEKLQARQQQLLKKIEHARTC
Download sequence
Identical sequences H0X3Q7
ENSOGAP00000009779 ENSOGAP00000009779 XP_003787452.1.62490 XP_003787453.1.62490 XP_012659180.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]