SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009785 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009785
Domain Number 1 Region: 390-623
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 1088-1345
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.22e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 767-920,960-1038
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-31
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 2-134,183-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009785
Domain Number - Region: 1350-1497
Classification Level Classification E-value
Superfamily EF-hand 0.0181
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009785   Gene: ENSOGAG00000010925   Transcript: ENSOGAT00000010935
Sequence length 2005
Comment pep:known_by_projection scaffold:OtoGar3:GL873611.1:6792736:7033597:-1 gene:ENSOGAG00000010925 transcript:ENSOGAT00000010935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGP
KHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEE
KPRNRSTPAGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGGDIEGENCGARLA
HRISKSKFSRYWRRWNRFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTE
VQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPL
GISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFG
GKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFI
ILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKP
VVEEAKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETAGKEDEEEPEMP
VGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSS
ISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDL
LVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVI
VTTLLQFMFACIGVQLFKGKLYTCSDSSKQTQAECKGNYITYKDGEVDHPIIQTRSWENS
KFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIA
FFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQGLCKRNANPCKPQIWQMYPAHKYLLSFD
LRILYVSVLKEVILLINKLCLLILQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFK
PKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVM
RLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEIN
RNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVF
YFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKH
LDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKT
EGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKR
KEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDD
IFRRAGGLFGNHVSYYQSDSRSAFPQTFTTQRPLHINKAGNSQGDTESPSHEKLVDSTFT
PSSYSSTGSNANINNANNTALGRRTRPTGPPSTVSTVEGHGPPLSPAVHVQEAAWRLSSK
RCHSRESQIAMVCPEEVFPGETYEVQRSEDTESCSEPSLLSTDMLSYQDDENRQLTPPED
KRDIRQSPKKGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGL
SPLLQRSHSPTSAPRPFATPPATPGSRGWLPQPIPTLRLEGAESSEKLNSSFPSIHCGSW
AEGPVPCGGGSSAARRARPVSLTVPSQAGARGGQFHGSASSLVEAVLISEGLGQFAQDPK
FIEVTTQELADACDMTIEEMESAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAGGEEDE
SCAHALGRRQSEEELQDSRVYVSSL
Download sequence
Identical sequences H0X3R3
ENSOGAP00000009785 ENSOGAP00000009785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]