SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009931 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009931
Domain Number 1 Region: 447-700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-69
Family Eukaryotic proteases 0.0000000117
Further Details:      
 
Domain Number 2 Region: 24-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-29
Family Spermadhesin, CUB domain 0.0000812
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-27
Family Spermadhesin, CUB domain 0.0000305
Further Details:      
 
Domain Number 4 Region: 376-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000681
Family Complement control module/SCR domain 0.0000195
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009931   Gene: ENSOGAG00000011095   Transcript: ENSOGAT00000011099
Sequence length 704
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:1662664:1674303:1 gene:ENSOGAG00000011095 transcript:ENSOGAT00000011099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLLYLLVPTLFCRVGSSNPIPQKLFGEVTSPLFPKPYPSNFETTTVITVPTGYRVKLFF
WHFDLEPSEGCFYDYVKISADKKNLGRFCGQPGSPLGNPPGKKEFLSQGNKMLLTFHTDF
SNEENGTIMFYKGFQAYYQAVDLDECASQHNLAEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQKDRHSCLAECSSELYTEPSGYISSLEHPNPYPPDLRCNYSIRVERGLTLHLKFLEPF
EIDDHQQVRCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
HYTTDIIKCPQPKTLDEFTIIQDLQPQYQFRDYFIVTCKQGYQLVEGQKALMSFTAVCED
DGTWHRAMPRCKIKDCGQPRSLTNGDFRYTTKEGVNTYQARIQYYCHEPYYKMQTRDGSS
ELERGMYTCTAQGIWKNEREGEKIPRCLPVCGKPVHPVEQKQRIIGGQRAKPGNFPWQAF
TNIYGRGGGALLGDRWILTAAHTLYPKDHDMQNNATVDVFLGHTKVQEIMKLGNHPVRRV
SIHPDYRQDESHNFEGDIALLELENSVTLGPNLLPICLPDNETFYDKDLMGYVSGFGITE
ERLSNDLRFVRLPVAMRELCENWLQEKKRNDVFSQNMFCAGDPTLKQDACQGDSGSVFAV
KGQDDRWVATGIVSWGIGCSRGYGFYTKLLNYVDWIKKEMEQES
Download sequence
Identical sequences H0X433
ENSOGAP00000009931 ENSOGAP00000009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]