SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009933 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009933
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 3.45e-36
Family Link domain 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009933   Gene: ENSOGAG00000011099   Transcript: ENSOGAT00000011101
Sequence length 277
Comment pep:known_by_projection scaffold:OtoGar3:GL873583.1:10431735:10448292:1 gene:ENSOGAG00000011099 transcript:ENSOGAT00000011101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFALLWEDAEGWGFRNGIFHNSIWLEQAAGVYHREARSGRYKLTYAEAKAVCEF
EGGRLATYKQVEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPKEYEDNQICYWHIRLKYGQRIHLSFLNF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDVLPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVTIDPVSKSSQGKNTSTTSTGNKNFLAGRFSHI
Download sequence
Identical sequences H0X435
ENSOGAP00000009933 XP_003793062.1.62490 ENSOGAP00000009933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]