SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009938 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009938
Domain Number 1 Region: 31-78
Classification Level Classification E-value
Superfamily Mitochondrial cytochrome c oxidase subunit VIIb 7.32e-27
Family Mitochondrial cytochrome c oxidase subunit VIIb 0.0000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009938   Gene: ENSOGAG00000011105   Transcript: ENSOGAT00000011107
Sequence length 80
Comment pep:novel scaffold:OtoGar3:GL873694.1:2002178:2010225:-1 gene:ENSOGAG00000011105 transcript:ENSOGAT00000011107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLAKNALSRLQVRYIQQTMARASHQKRTPDFHDKYGNAVLASGATFCIAVWTYVMTQI
GIEWNLSPVGRVTPKEWRDQ
Download sequence
Identical sequences H0X440
ENSOGAP00000009938 ENSOGAP00000009938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]