SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009997 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009997
Domain Number 1 Region: 142-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.18e-78
Family Transglutaminase core 0.00000151
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily E set domains 6.3e-42
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-28
Family Transglutaminase, two C-terminal domains 0.00079
Further Details:      
 
Domain Number 4 Region: 471-582
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-25
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009997   Gene: ENSOGAG00000011165   Transcript: ENSOGAT00000011171
Sequence length 688
Comment pep:known_by_projection scaffold:OtoGar3:GL873569.1:9922980:9940733:-1 gene:ENSOGAG00000011165 transcript:ENSOGAT00000011171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TALGIKSCDFQVSRNNEEHHTEAISSQRLIVRRGQPFSITLHFHAPVWSFLPALKKVKLI
AQTGEQPSKTNGTQATFPISSVGDQKWWNAVVTERDVQSWTISVTTPVDAVIGHYSLLLQ
VSGKEHRLGKFTVLFNPWGREDAVFLGNEAQRWEYLLNQNGLIYLGTADCIQAESWDFGQ
FEGDVIDLSLNLLSVDKKVAEWSQPEHVACVLGALLRTLKEKYVLPMPHTLDGQEQTLLN
KRRGSVPILRQWLTGQGRPVYDGQAWVLAAVTCTVLRCLGIPARVVTTFGSVQGTRGGLL
VDEYYNEEGLQNGEGQRGRIWIFQTSTECWMARPALPQGYDGWQILHPSAPSERGVPGFC
DLVPVRAVKEGTLGLTPAVSDLFAAVNASCVVWKSCEDGTLELTDSNTKYVGNNISTKGV
GSDRCEDITQNYKYPKGSLQEIEVLERVQKERMEHGKDDDIHPPSLESADPFFLFLEAPS
SLPLRGDDQLSVTLVNPSDQEKVVQLALGVQAVYYNGVLAAKLWRESLSLKLSANLVRRI
TTSLSFSLFEQNPPENSFLRLTAVATHSESRFSCFAQEDIAICKPHLDIEMPEKAEQYQP
LMASVSIYNSLDAPMKDCVISILGRGLIYRERSYRLNSVRPGHTVCTQFQFTPTHVGVQK
LTVELDCNMFQNLTSYKSVTVVAPELPA
Download sequence
Identical sequences H0X488
ENSOGAP00000009997 ENSOGAP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]