SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010021 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010021
Domain Number 1 Region: 638-774
Classification Level Classification E-value
Superfamily EF-hand 0.00000000127
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 466-521,558-682
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000212
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000010021
Domain Number - Region: 134-185
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 0.085
Family Ribosomal proteins L15p and L18e 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010021   Gene: ENSOGAG00000011193   Transcript: ENSOGAT00000011196
Sequence length 964
Comment pep:known_by_projection scaffold:OtoGar3:GL873558.1:2526968:2577257:-1 gene:ENSOGAG00000011193 transcript:ENSOGAT00000011196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTRARAQPGGRAGRGGSSLAPPPATLRGRRARGAGLAAAGGLREQRGLEIEMERIRQAAA
RDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEEEEEEVEGEEGGMVVEMDVEWRPGS
RRSAASSGVSSAGARGLGGYHGAGHPGGRRRRREDQDPPCAGPAGGGDPLRRHLPLDGQP
PRVAWAERLVRGLRGLWGTRLMEESSTTREKYLKSVLRELVTYLLFLIVLCILTYGMMSS
NVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTQGSLLDGLYWKMEPGNQTEAD
NRSFIFYENLLLGVPRIRQLKVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGT
AWIYTSEKDLNGSSHWGIIGTYSGAGYYLDLSRTREETAAQIASLKKNVWLDRGTRATFI
DFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPVKLIHYVTAFDFFLAACEIIFCFFI
LYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIHRTSNVGVLLQFLEDQNT
FPNFEHLAYWQIQFNNVAAVTVFFVWIKLFKFISFNRTMSQLSTTMSRCAKDLFGFAIMF
FIIFLAYAQLAYLVFGTQIDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTF
VFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALAKLKLKKNTVDD
ISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLER
EREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHISRRRGSISSGVSYEEFQVLVR
RVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLEGVAEDERLGRDSEIHREQ
MERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGTEGGGGNGNS
NIHV
Download sequence
Identical sequences H0X4A8
ENSOGAP00000010021 ENSOGAP00000010021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]