SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010081 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010081
Domain Number 1 Region: 243-333
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.86e-34
Family ets domain 0.00000724
Further Details:      
 
Domain Number 2 Region: 114-214
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.48e-29
Family Pointed domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010081   Gene: ENSOGAG00000011260   Transcript: ENSOGAT00000011264
Sequence length 335
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:5237855:5245605:-1 gene:ENSOGAG00000011260 transcript:ENSOGAT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSASPGLSSVPPSHLLLPPNTASRTGLEKVAAGVVGTERQDWTPSPPTTPEQGLSAFYL
SYFDMLYPEDSSWATKDPGASTQEETPEEPEQCPVIDSQAPGGSLDLVPGGLTLEEHSLE
QVQSMVVGEVLKDIETACKLLNITADPVDWSPGNVQKWLLWTEHQYRLPPVGKAFQELGG
KELCAMSEEQFLQRSPLGGDVLHAHLDIWKSAAWMKERTSPGVMHYCASTSEESWTDNEV
DSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAM
NYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Download sequence
Identical sequences H0X4F8
ENSOGAP00000010081 ENSOGAP00000010081 XP_012660177.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]