SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010125 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010125
Domain Number 1 Region: 82-164
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010125   Gene: ENSOGAG00000011305   Transcript: ENSOGAT00000011309
Sequence length 239
Comment pep:known_by_projection scaffold:OtoGar3:GL873717.1:1335493:1346163:-1 gene:ENSOGAG00000011305 transcript:ENSOGAT00000011309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGRRRAEPAGAGRAAAAAVPGRAGGSSRRMELNSLLILLEAAEYLERRDREAEHGYASV
LPFDGDFSRKKTKAAGLVRKAPNTRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHT
TLSLLKRAKVHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSVQSMERVRTDSTGSAV
STDDSEQEVDIEGMEFGPGELDSIGSSSDVDDHYSLQSGGGSDGGYRPHCRRPAHPGLS
Download sequence
Identical sequences H0X4J3
ENSOGAP00000010125 ENSOGAP00000010125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]