SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010132 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010132
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-39
Family VPS36 N-terminal domain-like 0.000000439
Further Details:      
 
Domain Number 2 Region: 277-385
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-29
Family MarR-like transcriptional regulators 0.073
Further Details:      
 
Domain Number 3 Region: 189-311
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000182
Family Vacuolar sorting protein domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010132   Gene: ENSOGAG00000011312   Transcript: ENSOGAT00000011316
Sequence length 386
Comment pep:known_by_projection scaffold:OtoGar3:GL873740.1:667182:714484:1 gene:ENSOGAG00000011312 transcript:ENSOGAT00000011316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDHKNHECCMA
IPLSQIVFIEEQAAGIGKSAKIVVHLHTAPPNKEPGPFQRSKNSYIKLSFREHGQIEFYR
RLSEEMTQRRWENVPVSQSLQTSRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKEKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQVPLQERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
Download sequence
Identical sequences H0X4K0
ENSOGAP00000010132 XP_003801848.1.62490 ENSOGAP00000010132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]