SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010149 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010149
Domain Number 1 Region: 25-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.85e-58
Family Proteasome subunits 0.00000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010149   Gene: ENSOGAG00000011331   Transcript: ENSOGAT00000011334
Sequence length 235
Comment pep:known_by_projection scaffold:OtoGar3:GL873575.1:46053:65926:1 gene:ENSOGAG00000011331 transcript:ENSOGAT00000011334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSGQKYQGMEPHSAAGPLQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTR
DSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYS
RRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNM
QNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALKICIVTRDGTREETIPLRKD
Download sequence
Identical sequences H0X4L5
ENSOGAP00000010149 ENSOGAP00000010149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]