SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010162 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010162
Domain Number 1 Region: 254-563
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-115
Family Transglutaminase core 0.0000000186
Further Details:      
 
Domain Number 2 Region: 97-249
Classification Level Classification E-value
Superfamily E set domains 1.08e-44
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 689-788
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-29
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 
Domain Number 4 Region: 577-688
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-29
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010162   Gene: ENSOGAG00000011344   Transcript: ENSOGAT00000011347
Sequence length 818
Comment pep:known_by_projection scaffold:OtoGar3:GL873744.1:1855138:1868997:-1 gene:ENSOGAG00000011344 transcript:ENSOGAT00000011347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGLRSDVGRWGGSPFQPPTTPSPEPEPDRRSRRSGRSFWARCCGCCSCRSGADDDWGP
EPSGSRGRGSSTRGGRSDSRGSDTRRPGSRGSAVNAAGDGTIREGMLVVTDVDLLSSRSG
QNRREHHTDEFEYEELIVRRGQPFCMVIVLSRPYESSDNITLELLIGNNPEVGKGTRVII
PVDKRGSGGWKAQVIKASGQNLNLRVHTAPNAIIGKFQFTVRTHTDAGEFQLPFDPRNEI
YILFNPWCPGDTEDIVFVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMRDDV
THIYKHPEGSEAERKAVETAAAHGSKPNVYANRDSAEDVAMQVEAPDAVMGQDLTLCVLL
TNRSSSSRTVKLHLYLSVTFYTGVTGTIFKETKKEVVLAPGASDRVAMPVAYKEYRPHLV
DQGAMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPIT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPASGGGGFFSDAGGGSSPSGEAIPMASRGGA
Download sequence
Identical sequences H0X4M7
ENSOGAP00000010162 ENSOGAP00000010162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]