SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010260 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010260
Domain Number 1 Region: 885-1042,1094-1161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-25
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 383-603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-19
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 36-203,259-328
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000345
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 1211-1451
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000141
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010260   Gene: ENSOGAG00000011448   Transcript: ENSOGAT00000011463
Sequence length 1773
Comment pep:known_by_projection scaffold:OtoGar3:GL873553.1:10092174:10402683:-1 gene:ENSOGAG00000011448 transcript:ENSOGAT00000011463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKQSSRVEAQPVTDFGPDECLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDNSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLTRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDAAGGWQ
LVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNHYKGENFRRQYDEFYL
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVL
RVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTF
PRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILD
NLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRE
SFMKQFIDRQQQDTSCLLRSLPSAASSSCDHAKRSAIEDNKYIDQKLRKSVFSIRARNLL
EKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGK
SLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIV
GREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIVVTICSC
ISMMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIF
IYLVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLV
SILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEK
KPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVFV
FLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFR
AKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKI
IAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVT
LKMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAIT
VLFRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLN
LLVAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGR
LEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLE
YTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLSPPSIETTQPS
EDANAGSQDSSAQPETGSQQQLLSPTLSDRGGSRQDASDVGKPQRKFGQWRMPSGGYRQP
FLPENQTCEVRYGSQDPRRKEGEISQGFPAPKPISHSMPSVNLPFGGRTTMKSVVCKMNP
MTDAASCGSEVKKWWTRQLTVESDESGDDLLDI
Download sequence
Identical sequences H0X4V1
ENSOGAP00000010260 ENSOGAP00000010260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]