SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010273 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010273
Domain Number 1 Region: 139-454
Classification Level Classification E-value
Superfamily RNI-like 6.95e-76
Family 28-residue LRR 0.000000000582
Further Details:      
 
Domain Number 2 Region: 82-163
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000208
Family 28-residue LRR 0.0000584
Further Details:      
 
Domain Number 3 Region: 4-80
Classification Level Classification E-value
Superfamily RNI-like 0.000000000141
Family 28-residue LRR 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010273   Gene: ENSOGAG00000011472   Transcript: ENSOGAT00000011476
Sequence length 458
Comment pep:known_by_projection scaffold:OtoGar3:GL873779.1:336187:340549:-1 gene:ENSOGAG00000011472 transcript:ENSOGAT00000011476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMSLDIQCEQLSDTRWTELLPLIQQCQVVRLDDCGLTEVRCQDMSSALRANPALTELDL
RTNELGDAGVRLVLQALQGPTCTIQKLSLQNCCLTEAGCGVLPSMLRSVPSLRELHLSDN
PLGDAGLKLLCEGLLNPQCHLEKLQLEYCNLTAASCEFLASVLRAKPDFKELIVSNNDLS
EAGVRTLCQGLKDSACPLEALKLENCGVTAANCRDLCSAVASKTSLQALDLGSNRLGDAG
LTELCQGLLRPSFRLRTLWLWECGITAEGCHELCRMLCSLESLRELSLAGNELGDAGAQL
LCESLLAPGCRLESLWVKTCSLTAACCPLFSSVLAQNKCLLELQMSSNPLGDVGVQTLCQ
GLGQPGTVLRVLWLGDCDVSDVGCSSLASTLLANHSLRELDLSNNRMGDEGVRQLMGSLR
QPGCALEQLVLYDIYWSEEMDNQLRALEEDKPSLRIIS
Download sequence
Identical sequences H0X4W2
ENSOGAP00000010273 ENSOGAP00000010273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]