SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010299 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010299
Domain Number 1 Region: 309-518
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-59
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 501-663
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-34
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 685-846
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-22
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010299   Gene: ENSOGAG00000011501   Transcript: ENSOGAT00000011505
Sequence length 874
Comment pep:known_by_projection scaffold:OtoGar3:GL873576.1:10959308:11036514:1 gene:ENSOGAG00000011501 transcript:ENSOGAT00000011505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFYATKPFLGSPGKNILSFLKSTPTDCSSCPEITIVPPCPTTSTTTLVGQNVREEEAQG
INGRAPAKHAAASLKPQVPPKPFHLQNSPSSNIHQTPRHKALPSAIPRMEEVKPASASCV
SKEKPSKVSDLISRFEGGSALSNYSDLKKESAANLHAPRTPGRHGLTSTPQQKLLSLHPP
WRQGRDTDEPQVAETCVANGIMAAQSQMECEDDKVAALSPDTPIQTSEPLLGVHWVNGER
EETAAGPASPTTDDCDGNALDGGSSRTPSLDPVLTLEGGADEEAKSQEREDGESPLELEQ
LDQHQEIKETNEQKLHKIANELLHTERAYVNRLDLLDQVFYCKLLEEANRGSFPAEMVNK
IFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGFDNAMEL
VKNMTERIPQFKSVVEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDSPD
WNDAKKSLEIISTAASHSNSAIRKMDNLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKL
AARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQV
SGKERTLELQASSEQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVSTAELGKR
APRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGKLNKVCK
DCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQDPL
VLYMYGAPQDVRAQATIPLLGYLVDDMPRSADLPHSFKLTQSKSVHSFAADSEELKQKWL
KIIFLAVTGETPEGLDEHPAALDDHPDPKRKSDC
Download sequence
Identical sequences H0X4Y3
ENSOGAP00000010299 ENSOGAP00000010299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]