SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010366 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010366
Domain Number 1 Region: 99-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.96e-59
Family Astacin 0.0000688
Further Details:      
 
Domain Number 2 Region: 726-833
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-37
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 415-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 4 Region: 566-676
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 301-410
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-36
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 6 Region: 857-950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-27
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 7 Region: 677-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 522-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000295
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010366   Gene: ENSOGAG00000011582   Transcript: ENSOGAT00000011588
Sequence length 961
Comment pep:known_by_projection scaffold:OtoGar3:GL873696.1:1014292:1141040:1 gene:ENSOGAG00000011582 transcript:ENSOGAT00000011588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHGMSKRQGALYELIDRIR
RIGSGIIFQAKNVLNVTAGLEQNNTGQNEKNRVPRAATSRTERIWPGGVIPYIIGGNFTG
SQRAMFKQAMRHWEKHTCVTFIERSEEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNC
DKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYD
FDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGQT
LQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIILNFTTMDLYKSSLCWYDYIEVRDG
YWRKSPLLGRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQ
IQSPNYPDDYRPMKECVWKITVLEDYHVGLTFQAFEIERHDNCAYDYLEVRDGASENSPL
IGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECARPDRGGCTQRCVN
TLGSFQCACEPGYELGPDRRACEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPT
QYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGTEVPEVITSQFNNMRIEF
KSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECLNTMGSYICQCRNGFVLHENKHDCKEA
ECEQKIHSPSGLITSPNWPDKYPSRKECTWGISTTPGHRIKLAFSEFEVEQHQECAYDHL
EVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLK
AESKPRDLYSHSQFGDNNYPGQVDCEWLLVSERGSRLELSFLTFELEEEADCGYDYVELF
DGLDSTAVGLGRLCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKSIRYPDTKHTK
K
Download sequence
Identical sequences H0X538
ENSOGAP00000010366 ENSOGAP00000010366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]