SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010368 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010368
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-57
Family DBL homology domain (DH-domain) 0.0000401
Further Details:      
 
Domain Number 2 Region: 452-570
Classification Level Classification E-value
Superfamily PH domain-like 5.87e-31
Family Pleckstrin-homology domain (PH domain) 0.00083
Further Details:      
 
Domain Number 3 Region: 27-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000658
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010368   Gene: ENSOGAG00000011581   Transcript: ENSOGAT00000011590
Sequence length 987
Comment pep:known_by_projection scaffold:OtoGar3:GL873610.1:4327229:4355465:1 gene:ENSOGAG00000011581 transcript:ENSOGAT00000011590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIESLTRARIDRSKEPASKTREKEKMREAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRALSVESLIDEGAEVIYNELMSEFEMDEKDFTADSWSLAVDGSFLQQHKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRAGMLEELQLEPGVVQGLFPCVDELSDIHMRFLSQLLE
RRRQALSPGSTRNFVIHRLGDLLISQFSGPSAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLIGRILQYCHGSEEEHQDLTAAL
GLVKELLSNVDQDVHELEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCL
LWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQRSVCVCPSREDFPLIETEDEAYLRRIKMELRQ
KDQALVELLQEKVGLFAEMTHFQAEEDGNSGMSLPTLPRGLFRSESLESPRGERLLQDAI
REVESLKDLLVGPGVELLLMPREPALPLELDSGGNTSPGVTANGEARTFNGSIELCRADS
DSSQKDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLSR
ANSRDGEAGRSGAVPTAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARL
RESEQARAVLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNP
PQPSRGPDRLDLPVTIRSSQRPFEDRERQDLGSPEERLQDSSDPDTGSEEEGSSRPSPPH
SPRDFTRMQDIPEETESRDGEPIPSES
Download sequence
Identical sequences H0X540
ENSOGAP00000010368 ENSOGAP00000010368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]