SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010373 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010373
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily F-box domain 4.97e-16
Family F-box domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010373   Gene: ENSOGAG00000011591   Transcript: ENSOGAT00000011596
Sequence length 433
Comment pep:known_by_projection scaffold:OtoGar3:GL873546.1:4787151:4821295:1 gene:ENSOGAG00000011591 transcript:ENSOGAT00000011596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEILLKIFSYLDAVSLLCTGCVNRRLYHLANDNFIWIRIYSASFPPKRSNWKFNSIEE
TAVSLSALSVEDKEAGYWKTEYIARQMASVKATLAQVLKPVNPYTGLPVKTREALRKSGL
GWAIILKEKNGKEYVMKHADLSINDTSVTVVWYGKSWPCLASLSTLELYGLTPVFMDWCK
PPTRDRPRWHSLITKYHLSHLTESNLIGCDRLVRVFCLHPGLLVGLWKKEEELAFVMANL
HFHHLVERSTLGSASVPFEPPAHSPYLDDSPECGLHGYQLHVDLHSGGVFFLCGTFHNLF
IKKGIIENGYVKLIIINFKNDREHLPLIGKVGFSWRTDVFDGCIKSCFIMDITLLDEYGR
PFWCFSSPVCMRPTTPSDGPSFLGQTYHVEYVDTEGQVHVELVWIEETEEFFVVSLVLYL
SIGKINHWFGTKY
Download sequence
Identical sequences H0X545
ENSOGAP00000010373 ENSOGAP00000010373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]