SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010384 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010384
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000044
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.31e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000139
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.22e-39
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000128
Family AlaX-M N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010384   Gene: ENSOGAG00000011601   Transcript: ENSOGAT00000011608
Sequence length 968
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:9356901:9380117:-1 gene:ENSOGAG00000011601 transcript:ENSOGAT00000011608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDGKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGADDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGEA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGETKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAKGLEV
TDDSPKYNYHSDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKPVYTQDCPLSTAKAIQGLRAVFDETYPDPVRVVSIGVPVSKLLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAENLKTSLSIMEAK
VKVQTAPNKDVQREIADLGESLATAVIPQWQKDELRETLKSLKKIMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFAVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences H0X553
ENSOGAP00000010384 ENSOGAP00000010384 XP_012661601.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]