SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010452 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010452
Domain Number 1 Region: 1297-1459
Classification Level Classification E-value
Superfamily PH domain-like 3.35e-69
Family Pleckstrin-homology domain (PH domain) 0.00000431
Further Details:      
 
Domain Number 2 Region: 1083-1300
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-53
Family DBL homology domain (DH-domain) 0.0000000927
Further Details:      
 
Domain Number 3 Region: 506-621
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-19
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 860-975
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000226
Family PDZ domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010452   Gene: ENSOGAG00000011674   Transcript: ENSOGAT00000011683
Sequence length 1699
Comment pep:known_by_projection scaffold:OtoGar3:GL873645.1:1871846:1971757:-1 gene:ENSOGAG00000011674 transcript:ENSOGAT00000011683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMGNSESQYTLQGSKNHSNTVTGAKQKPCSLKIRGTHAKDEKSLPGWGHGSGGAGYKSR
SLARSCLSHFKSYQPYASRLGGPTCKASKGLAYSKHRTNAPGRDFQGSNAAFPPENGFVC
VGPQPAENHVTSRDCRGRLLTCYGRSESLARTPPGEGGRSPRVLIRTLGKLDGCLRVEFH
SGGGQGRAPVEAAGGPVRLLRYSPTPASGAPGPVAGQAEGAESPPGRRASPAGSRLRSSK
GSSLSSESSWYDSPWGNAGELSEADGSSLAPGTPDPGLPAGFPPGDTKKPFSQSASLSSL
RDLYKDGALGSLSPSGVSDEYLGAHAGLSPRVSFASDIDVPSRVARRDPVPYGSFTLPCR
KPKALTEDTAKKDTLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNIDGQ
GPSQPSALLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENVETSTD
SAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVM
LKGCTLLFYETYGKNCTDQSSAPRCALLAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQ
ATSQTDLENWVTAIHSACASLFAKKRGKEDTVRLLKTQTRSLLQKIDMDSKMKKMAELQL
SVVSDPKNRKAIENQIQQWEQNLEKFHMELFRTRCYLASLQGGELPNPKSLLAAASRPSK
LALGRLGVLSVSSFHALVCSRDDSAFRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKEK
RPSITQVEDVHVCGSPVDGVPRDNAWEIQAYVHFQDDQGVTVTIKPEHRVEDILTLACKM
RQLEPSHYGLQLRKLVDDSIEYCIPAPYEYMQEQVYDEIEVFPLGVYDVQLTKSGSASDF
GFAVTAQVDGQQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEALFS
EKSVGLTLIARPPDTKATLCSSWSDSDLFSRDQKGLLPPANQSQLLEEFLDNFKKNTAND
FSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRSAEQIAALCRSFTATETSGMEGPRDG
QDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQSETFLTQDEMES
LFGSLPEMLEFQKVFLETLEDGISAASDFNILETPSQFRKLLFSLGGSFLYYADHFKLYS
GFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLKEL
VSLTDHESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELS
MGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHN
SADLDTFKFRWLIPISALQVRLGNTAGTENNSLWELIHTKSEVEGRPETIFQLCCSDSES
KTSMVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKNSS
SSEWTHETGKGNSLDSDECSLSSSTQSSGCHTAESRQDSKSTSPGKYPPSGLADLVDNLI
KESDILSDEDDDYHQTLKRASPTKDIEIQFQRLRISEDPDAHPPAEPQPGTEVGEGRKGG
EQPRLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSHSENANMDLNSVLEREFSVQS
LTSVVNEDCFYETESHGKS
Download sequence
Identical sequences H0X5A8
ENSOGAP00000010452 ENSOGAP00000010452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]