SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010549 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000010549
Domain Number - Region: 253-342
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000875
Family Gamma-glutamyltranspeptidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010549   Gene: ENSOGAG00000011790   Transcript: ENSOGAT00000011792
Sequence length 350
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:9473820:9487553:-1 gene:ENSOGAG00000011790 transcript:ENSOGAT00000011792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYAGLQRL
SKEGLAGKSCACHRCMGDAGSSDWFDSHFDSNISPVWTRENMDLPPDVQRWWMMLQPQFK
SHNTNEVLEKLFQIVPGENPYRVRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLLWIASALSTGQIRFTY
APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Download sequence
Identical sequences H0X5I5
XP_003791418.1.62490 ENSOGAP00000010549 ENSOGAP00000010549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]