SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010605 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010605
Domain Number 1 Region: 78-201
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.51e-48
Family Regulator of G-protein signaling, RGS 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010605   Gene: ENSOGAG00000011853   Transcript: ENSOGAT00000011855
Sequence length 209
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:2439024:2442688:-1 gene:ENSOGAG00000011853 transcript:ENSOGAT00000011855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAAISRSDLDRMPGMFFSANPKELKETGHSLLDDKTQKRRPKTFGMDMKAYLRSMIPH
LESGMKPSKSREILSAAEVLQWSQSLEKLLATQTGQDVFGNFLKSEFSEENIEFWLACED
YKKTDSDLLRCKAEKIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK
Download sequence
Identical sequences H0X5N4
ENSOGAP00000010605 XP_003785654.1.62490 ENSOGAP00000010605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]