SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010635 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010635
Domain Number 1 Region: 1207-1362,1401-1480
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.41e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1531-1779
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.41e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 718-865,899-946
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.47e-30
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 4 Region: 132-276,352-421
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-29
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010635   Gene: ENSOGAG00000011885   Transcript: ENSOGAT00000011890
Sequence length 2020
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:389720:465452:-1 gene:ENSOGAG00000011885 transcript:ENSOGAT00000011890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFLLPRGTSSFRRFTRESLAAIEKRMVEKQARGSATSQESRDGLPEEEAPRPQLDLQA
SKKLPDLYGNPPRELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSYPLHMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILAR
GFCLHAFTFLRDPWNWLDFSVIVMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTI
VGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGTNGSVEADGL
VWESLDDYLNNPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFA
WAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQ
NQATIAETEEKEKRFQEAMEMLKKEHEALIIRSVDTMSRSSLEMSPLAPVTSHERRSKRR
KRMSSGTEECGEDRFPKSDSEDGPRAMNRLSLTHGLSRTSMKPRSSRGSIFTFRRRDLGS
ETDFADDENSTAGESDSHRTSLLVPWPLRRPSAQGQPSPGTSAPGHALNGKRNSTVDCNG
VVSLLGAGDPETISPGSRLLHPMMLERPPDTTTPSEEPGGPQMLTPQAPCMDGFEEPGAR
QRALSAVSVLTSALEELEESHRKCPPCWNRFAQRYLIWECCPLWLSIKQKVKFLVTDPFA
DLAITMCIVLNTLFMALEHYNMTAEFESMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQ
GWNIFDSIIVILSLMELGLSRMNNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGAL
GNLTLVLAIIVFIFAVVGMQLFGKNYSEQRHLISDSGLLPRWHMMDFFHAFLIIFRILCG
EWIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMN
NLQLALARIHRGLCFVKRTTWDFCCGLLRRRPQKPAALASRSQLPSCIGTPGSPPPPEME
KAPPARKETRFEEVKQPGQGTPGDPEPVCVPIAVAESDTDDQEEDEENSLGTEEESSKQQ
ESQPVSGGPEASPEPRTWSQVSETASSEAEASESQADWQQQQKAEHQASGCSETQEDSYS
EGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRKT
CYRIVEHSWFETFIIFMILLSSGALAFEDIYLEDRKTVKVLLEYADKMFTYVFVLEMLLK
WVAYGFKKYFTNAWCWLDFLIVDVSLISLVANTLGFAEMGPIKSLRTLRALRPLRALSRF
EGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGRFGRCINQTEGDLPLNYTI
VNNKSECESFNVTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQ
PQWEYNLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPLNKYQGFLFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKV
SILAKINLLFVAIFTGECIIKMTALRHYYFTNSWNIFDFVVVILSIMGTVLSDIIQKYFF
SPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMA
NFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNG
SRGNCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEI
WEKFDPEATQFIEYSALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAF
TKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLL
QRSMKHASFLFRQQVGSSGLSEEDAPEREGLIAYMMNENFSRPLSPPSSSSISSTSFPPS
YDSVTRATSDNLQVRVSDYSRSEDLADFPPSPDRDRESIV
Download sequence
Identical sequences H0X5Q8
ENSOGAP00000010635 ENSOGAP00000010635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]