SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010654 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010654
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-35
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 85-241,387-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 974-1007
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000342
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1008-1037
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000539
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010654   Gene: ENSOGAG00000011909   Transcript: ENSOGAT00000011913
Sequence length 1104
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:41255198:41356183:1 gene:ENSOGAG00000011909 transcript:ENSOGAT00000011913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVNTW
KAKALWYKLDKRGSHREYKRGKTCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALLLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPIDHALSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKDETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIKNDYIDTEMLLCAENVNQDNLLSYAREAADFATNYKLPCLDFARNH
YGQPDVAMFDFTSMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWSQGCSPLDLLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLFITKELDHCPLQRQGSLRRSISLSRRESDIRPNKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHHFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLGMVMYLSKFYELFRGTPLRPVDVWRRNYGDNADLSLAKSSISNNYLNLTFPR
KRTPRVDGQIGDSDLNKRRRKGFSNPEEPSTFSTCSLDSNQEGSSSREGGNQNKVKSMAN
QLLAKFEENTRNPSLLKQERRVSGIGKPVLCSSSDPPVHSRSPKPQEPTPSPSPPLKRQF
PPVVVTGHVLRELKQVSAGGECPSRPWRARAKSDLQLGRPENLAALSPPCQGTQALSGVL
RRLQQVEEKILQKRAQNLANREFHKKNIKEKAAHLASMFGQGDFPQNKLLSKGLSHTHPP
SSPSCLPSPDPAAPSSPATVDSASLSRKLTVGKVSSGIGAAAEVLVNLYMNDHRPKAQDT
SPDLECVRKSSFPLNLGGSDTCYFCEKRVYVMERLSAEGHFFHRECFRCSVCATILRLAA
YAFDSDEGKFYCKPHFIHCKANSKQRKRRAELKQQREEEGTWQEQEAPRRDTPSESSCAV
EAISTPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences H0X5S3
ENSOGAP00000010654 ENSOGAP00000010654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]