SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010724 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010724
Domain Number 1 Region: 264-556
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.67e-75
Family WD40-repeat 0.0000000000672
Further Details:      
 
Domain Number 2 Region: 150-262
Classification Level Classification E-value
Superfamily F-box domain 6.8e-27
Family F-box domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010724   Gene: ENSOGAG00000011988   Transcript: ENSOGAT00000011991
Sequence length 580
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:5192424:5246173:1 gene:ENSOGAG00000011988 transcript:ENSOGAT00000011991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQPLWVVCICFSASVIRASCVTGRETCSMTILLNTSVMEDQNEDESPKKNTLWQFYSQC
LRVCFHLFVFCFSSGSEDIGHIVSFEKISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQ
WSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDAR
SLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPN
SFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSI
KIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEA
VLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGD
RTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH
EELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDE
FQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Download sequence
Identical sequences H0X5X3
ENSOGAP00000010724 ENSOGAP00000010724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]