SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010774 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010774
Domain Number 1 Region: 42-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010774   Gene: ENSOGAG00000012044   Transcript: ENSOGAT00000012045
Sequence length 119
Comment pep:known_by_projection scaffold:OtoGar3:GL873675.1:58043:58510:-1 gene:ENSOGAG00000012044 transcript:ENSOGAT00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALSPVRGCYEAVCCLSERSLAIARGRSKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRNFCH
Download sequence
Identical sequences H0X620
XP_003799799.1.62490 ENSOGAP00000010774 ENSOGAP00000010774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]