SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010776 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010776
Domain Number 1 Region: 206-306
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 8.37e-35
Family E2F dimerization segment 0.0000787
Further Details:      
 
Domain Number 2 Region: 129-193
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.98e-16
Family Cell cycle transcription factor e2f-dp 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010776   Gene: ENSOGAG00000012045   Transcript: ENSOGAT00000012047
Sequence length 438
Comment pep:known_by_projection scaffold:OtoGar3:GL873675.1:12979:32908:-1 gene:ENSOGAG00000012045 transcript:ENSOGAT00000012047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPRVLVPAGGQPPKGLPSMSPTELWSPGLSSPQLCPTTTTYYTALYPQTVPPAAAPG
TCLDATPHGPESQVVRCVPAGRLPAKRKLDLEGIGRPAIPEFRTPKGKCIRMDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGIFEDPTRPGKQQQLKQELKELMSMEQALDQLIQSCSLNFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPEKPEENLQIYLKSTQGPIEV
YLCPEEQEPDSPAKEPLPSTATLSPSPDSAQPSSSTHPRMMEPRASSAPSPSLQQIPPPP
PPPPSLVPLEATDSMPELPHPLLQQTEDQFLSPTAACSSPLISFSPPLDQDDYLWGLDGG
EGISDLFDSYDLGDLLIN
Download sequence
Identical sequences H0X622
ENSOGAP00000010776 ENSOGAP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]