SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010800 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010800
Domain Number 1 Region: 153-374
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-49
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 377-511
Classification Level Classification E-value
Superfamily PH domain-like 9.68e-21
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010800   Gene: ENSOGAG00000012066   Transcript: ENSOGAT00000012072
Sequence length 792
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:2436628:2452432:-1 gene:ENSOGAG00000012066 transcript:ENSOGAT00000012072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALSPPDEGPLHGHVASLIETYGGGHRVSTQSTAASLHHRGGGPVLDPSRRNFQHYVHF
AKGSGQARGLPPIKLREPEHEKKHGGHSGAGPPYSPKLKDVTKLQKLEMRLHTFSMFGMP
RLPPDDRRRWEIGEGGDSGLAIETSWRELVPGHKEMSRELCHQQEAVWELLTTELIYVRK
LKIMTDLLAAGLLNLQRVGLLMDVSAETLFGNVPSLIRVHQSFWEEVLGPTLEETRTSGQ
PLDPVSLQSGFLMFGQRFQPYVQYCLQVKQTMAYAREQQDTNPLFHVFVQWCEKHKSSGR
QMLGDLLIKPYQRITKYPLLLQAVLKRSPGVQTQEALNAMIAAVESFLRHINGQVRQGEE
HESLVAAAQRIGPYEVLEPLSEEVEKNLRPFSTLDLMSPMLGVSSEHMRQLLLEGPVRLK
EGQGREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVFRPLRDPHNFLVIHL
TEFQCVSSALIVHCPSPTDRARWLEKTQQAQATLQKLKAEEYVQQKRELLALYRDQDRES
PSTRPSTPSLEGSQSSTEGRTSELSAIIPHLVVTEDTDEDAPSVPDDTSDSGYGTLIPGS
PKRSHSPLSRLRQRALRRDPRLTFSTLDLRDVPLRPQPPDPQALQRRSAPELPEGIRRGG
SLPRGDPPTWSEEEDGTSMGRNVVVETLHRARLRGQLPHSPTHADSAGESPWESSGDEEE
EGPLFLGPDCTASPHHLRAEDMLREIREELASQRIEGAPDPRDNRPRKLTQAQLRRMRGR
HIIQLDTPLSTS
Download sequence
Identical sequences H0X644
ENSOGAP00000010800 ENSOGAP00000010800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]