SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010808 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010808
Domain Number 1 Region: 106-292
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-73
Family F-box associated region, FBA 0.000000021
Further Details:      
 
Domain Number 2 Region: 42-134
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000144
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010808   Gene: ENSOGAG00000012077   Transcript: ENSOGAT00000012080
Sequence length 292
Comment pep:known_by_projection scaffold:OtoGar3:GL873586.1:8255170:8260126:-1 gene:ENSOGAG00000012077 transcript:ENSOGAT00000012080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEDQPEEASAEEERPEDQEEDEEAYLAELPEPLLLRVLAELPA
AELVQACRLVCQRWRELVDGAPLWLLKCQQEGLVPEGGTEDERDHWQQFYFLSKRRRNLL
HNPCGEEDLEGWIDVEHGGDGWRVEELPGDCGVEFTHDDSVKKYFASSFEWCRKAQVIDL
QAEGYWEELLDTTQPAIVVKDWYSGRCDAGCLYELTVKLLSEHEDVLAEFNSGQVAVPPD
SDGEGWVEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSGVWVEP
Download sequence
Identical sequences H0X652
ENSOGAP00000010808 XP_003793320.1.62490 ENSOGAP00000010808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]