SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010843 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010843
Domain Number 1 Region: 339-529
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-44
Family cAMP-binding domain 0.00029
Further Details:      
 
Domain Number 2 Region: 104-333
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-23
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010843   Gene: ENSOGAG00000012116   Transcript: ENSOGAT00000012120
Sequence length 694
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:38493875:38575514:1 gene:ENSOGAG00000012116 transcript:ENSOGAT00000012120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPESKPPRAPVINKYADAQLHNLVKRMRQRTVVYKRKLGEGDLSSPEASPQAAKPTAVSS
AQESDTKLPKEHYHSLLCCRFQEVPLTEYLKRIRLPESIDSYSDRFYLLWLLLVTIAYNW
NCWLIPLRCFFPYQTPGNTCYWLITDVTCDLIYLCDMLFIQPRLQFIKGGDTIVDSNELK
RHYRSSTKFHLDVASIIPFDVFCLFFGFNPIFRTNRILKYTSFFEFNHHLEAVMDRAYIY
RVFRTTGYLLFTLHINACIYYWASNYEGIGTTRWVYNGEGNKYLRCYYWAVRSLITIGGL
PEPQTLFEIVFQLINFFSGVFVFSSLIGQMRDIIGAATANQSNFRVYMDHTTAYMNKYSI
PRSVQKRVRTWYEYTWASQRMLDESDLLKNLPTTVQLALAIDMNFSIISKVDLFKGCDTQ
MIYDMLLRLKSTLYLPGDFVCKKGEIGKEMYIIKQGQVQVLGGPDGAQVLVTLKAGAVFG
EISLLAAGGGNRRTADVVAHGFANLLTLEKKTLQDILRHYPDSGKLLMKKARVLLTQKDK
GATATPPKKELAFLFPPKEETPKLFKILLGGAGKASLAKLLDLKTEQTAQKKRERNGERE
GGREEERRRKERKERDKRENTEEGKGKGREPAEEPADSSKLTSSSIPTQEQPLSMRRSVL
PRGTTRQSLIISMAPSAEAGEEILTIEVKEKAKQ
Download sequence
Identical sequences H0X681
ENSOGAP00000010843 ENSOGAP00000010843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]