SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010914 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010914
Domain Number 1 Region: 14-171
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 7.06e-39
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010914   Gene: ENSOGAG00000012202   Transcript: ENSOGAT00000012203
Sequence length 181
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:3361447:3364059:-1 gene:ENSOGAG00000012202 transcript:ENSOGAT00000012203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELSKLGLGSDVELELQTLQLHVDYRAAGQRVARIWEDLQPQLTVHVGMDTSGKAIVLEQ
CGKNRGYRDADVRGFRPEDGVCLPGGPEVITSVVSMKTVCRCIVIEDIEVAFSRDAGRYV
CDYTYYLSLHHGCGSAALIHVPPLSLRVSASLLGRALQIIIRKMLEECEKAQEQSLTHGK
L
Download sequence
Identical sequences H0X6D8
ENSOGAP00000010914 ENSOGAP00000010914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]