SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010965 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010965
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-23
Family Kringle modules 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010965   Gene: ENSOGAG00000012258   Transcript: ENSOGAT00000012260
Sequence length 263
Comment pep:known_by_projection scaffold:OtoGar3:GL873813.1:776122:787567:-1 gene:ENSOGAG00000012258 transcript:ENSOGAT00000012260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQTFLVSKMLLAEAYGSGVCFWDNGHLYRADQPSPAPGLHCLNWLDAQSDLASAP
ELGAGNHNYCRNPDRDPRGPWCYVSSEAGVPEKQPCEDLRCSETTSQAPLASMTETEAAL
KMPVEDEVQVFAPANALPARSEAAAVQPVIGISQRVRMNAKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYTYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIMDEKTVVVHA
SQTPVEIQEGNIPFMDQAGTPGA
Download sequence
Identical sequences H0X6I1
XP_003803387.2.62490 ENSOGAP00000010965 ENSOGAP00000010965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]