SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011042 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011042
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 2 Region: 118-307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000897
Family Pentraxin (pentaxin) 0.0034
Further Details:      
 
Domain Number 3 Region: 821-1105
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000714
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011042   Gene: ENSOGAG00000012338   Transcript: ENSOGAT00000012344
Sequence length 1160
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:6409843:6476025:-1 gene:ENSOGAG00000012338 transcript:ENSOGAT00000012344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCANCRVVLSSPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIY
DSLSLDNGESLTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQ
KVVLPQTPDAYQVSVAKSVSIPELSAFTLCFEATKVGSEDPEWMAFSYSSPSLPHALNFG
KAKSGYFLSISGSKCLLNSAFPDTEKEDIFTESFEQLCLTWNNSLGSVGVNFKRNYETVL
CDSTISKVIPGGGRLVLGSNQSEIASLKGDIYNFRLWNFTMNSKILSNLTCNMKGNVVDW
QNDFWNVPTLALKAESNLSCGSYLIPLPAAELVNCADLGTLCQATVSPPSTAPPIVTTNM
PVTNRLDIQTNDGIIYRISVVIQNILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFH
QSTGEDKIKVKRSLANDQRMVILALLVYNATNNTNLEGRTIQQKLLKNNESLEEGLFLYT
VNVRQMVSTCPAEEEPKGYFWPNIVPSEYTMNCPKRPGYFATRTCYSNAANSSAYWGPPD
TSDCLRNTAPNEVANEILNTTDGQNLTSADITNIVEKVKRIVNNEDNIDITLGSTLMNIF
SNILSSSDSNLLESSSEALKTIDELAFKIDLNSTQHVNITTQNLALGVSSLSPGTNGISN
FSIGLPSNNESYFQMDFENRQMDPLASVILPPNLLENLSPENSVLVRRAQFTFFNKTGLF
QDVGLEGKTLVSYVMACSIGNITIQNLSEPVQIKIKHTRAQDVHHPPICAFWDMNKNKSV
GGWNTSGCVAHSSDASETVCLCTHFTHFGVLMDLKINPTPIDIWNTKVLTFISYVGCGIS
AIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLIFLLDSWVSSFHVDGLCTAIAA
LLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWGLPALVVSIILASRNQ
NEVYGRKSYGKEKGDEFCWIQDPVVFYVSCAGYFGVMFFLNVAMFIVVMVQICGRNGKRS
SRTLREEVLRNLRSVVSLTFLLGMTWGFAFLRWGPLNVLFVYLFSIFNSLQGLFIFIFHC
AMKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTS
KSKSSSTTYSKRNSHPDNVS
Download sequence
Identical sequences H0X6P1
ENSOGAP00000011042 ENSOGAP00000011042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]